Table 1.
List of Primary Antibodies Used in the Current Study
| Antigen | Immunogen | Host | Working dilution | Source | Catalog no. |
|---|---|---|---|---|---|
| Brn-3a | Ami no acids 186–224 of Brn-3a fused to T7 gene 10 protein | Mouse | 1:500 | Chemicon | Mab1585 |
| Chx10 | Recombinant N-terminal amino acids 1–131 of human Chx10 conjugated to GST | Sheep | 1:300 | Exalpha | X1180P |
| Syntaxin (HPC-1) | Synaptosomal plasma-membrane fraction from adult rat hippocampus | Mouse | 1:500 | Sigma | S0664 |
| Choline acetyltransferase (ChAT) | Purified ChAT from human placenta | Goat | 1:200 | Chemicon | AB144P |
| Neuropeptide Y (NPY) | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY | Rabbit | 1:1000 | Bachem | T-4069 |
| Tyrosine hydroxylase (TH) | Purified TH from rat pheochromocytoma | Rabbit | 1:500 | Chemicon | AB152 |
| Glutamate Decarboxylase Gad65/67 | Peptide [C]DFLIEEIERLGQDL from rat GAD65 | Rabbit | 1:1000 | Chemicon | AB1511 |
| Glycine transporter 1 (GlyT1) | Peptide from C-terminus of rat GlyT1, AG994 | Goat | 1:5000 | Chemicon | AB1770 |
| Vesicular glutamate transporter 3 (Vglut3) | Peptide from rat Vglut3, AG320 | Guinea pig | 1:2500 | Chemicon | AB5421 |
| Ebf | C-terminal peptide of the Ebf-1 protein (NGNSLQAISGMIVPPM) |
Rabbit | 1:2000 | Gift from R. Reed | |